PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 1040aa    MW: 115901 Da    PI: 9.9411
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550977.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.67e-094480340
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                      WT+ E e+++da +++G + Wk++a+ + ++R+ +++
   XP_010550977.1 44 QWTKGELERFYDAYRKHGQD-WKKVAASVRNNRSVEMV 80
                     6*****************99.*********99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.194094IPR017884SANT domain
SuperFamilySSF466895.38E-84390IPR009057Homeodomain-like
PfamPF002493.8E-74481IPR001005SANT/Myb domain
CDDcd001678.52E-44587No hitNo description
SMARTSM011357.7E-59620721IPR033471DIRP domain
PfamPF065845.5E-32620720IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1040 aa     Download sequence    Send to blast
MAPGRKSRSV NKRFSNETSP EKDVWNSSKS KQRKKKLSDK LGPQWTKGEL ERFYDAYRKH  60
GQDWKKVAAS VRNNRSVEMV EALFYMNRAY LSLPEGTASV AGLIAMMTDH YSVMDGSDSE  120
GEGHAASGVR KKYQKGKRTK ESREETNIPH SIASADGCLS FLKQAQAFGS QRRATGKRTP  180
RFPVPSSYRR EDREGSTPLS KRARKPVDND DVAHFVALAL TDASKRGGSE SPYRRTEHSD  240
SSPIKSWGKM SQAREAQSKL RDSSMCEEWV EGNRERKRKK GGSDRDATSL MDMEGVGTVE  300
VLRRGKKFYG KKAKVEEAKG IDSDDSGEAC SATEGLRSKS QKGKVDVEAS RGKFSPHGPK  360
KRNKKLQFGD EFDALQALAE LSASMLPAAL MESESSAQLK EEGTANDMDE KSSTPEATST  420
SHHGEKSKQV EPEESVLHAI SAVENTKYRK PKSSRQASAD GIAGPAGKQQ QQPSGTLRRR  480
RKPKVLDAEP PTDSNQNKST LMKESAHDEN AKSVVKTKRT VQVPAQSKQL KTVKTLEESS  540
SASDKKTLPV SASASLPQKP QNRRKMGLKK TLQERVKFSE TTPKASYVNE SLLEHELLKE  600
KLSSCLSYPL ARRRCIFEWF YSAIDYPWFA KMEFVDYLNH VGLGHVPRLT RLEWSVIKSS  660
LGRPRRFSER FLQEERDKLK QYRESVRKHY TELRAGAREG LPTDLARPLS VGNKVIAIHP  720
KTREIHDGKI LTVDHNKCSV LFDRDDLGVE FVKDIDCMPL NPLEYMPEGL RRQIDMCMAI  780
SKEAHLNRHP NFEGSVIFPS SVLENASLYM KQGDTNGPIL QAKILATNTT SPQQATNNHP  840
FITTFSKARE VEIQRALAVQ RSLNEKEIEP EMLEIVKGSK SRAQAMVDAA IKAASSVKEG  900
EDASKKIQEA IDSIGKHLPL HSSMVPGVKH QEHANGSLDH HLSQSPSDAL ESLVNGSISQ  960
DGSGKNEGQM PSELISSCVA TWLMIQMCTE RQYPPADVAQ LIDTAVMSLH PRCPQNLPIY  1020
REIQTCMGRI KTQILALVPT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275279RKRKK
2476482LRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550977.10.0PREDICTED: protein ALWAYS EARLY 2-like isoform X1
SwissprotQ6A3330.0ALY2_ARATH; Protein ALWAYS EARLY 2
TrEMBLV4M3T70.0V4M3T7_EUTSA; Uncharacterized protein
STRINGAT3G05380.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29622241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.21e-144DNA binding